Welcome to ProbeChem!Global Supplier of Chemical Probes, Inhibitors & Agonists.

You are here:Home-Chemical Inhibitors & Agonists-GPCR-Vasoactive intestinal peptide receptor (VIPR)-BAY 55-9837
BAY 55-9837

Chemical Structure : BAY 55-9837

CAS No.: 463930-25-8

BAY 55-9837 (BAY55-9837)

Catalog No.: PC-20661Not For Human Use, Lab Use Only.

BAY 55-9837 is a potent, highly selective peptide agonist of vasoactive intestinal peptide receptor 2 (VIPR2, VPAC2 receptor) with Kd of 0.65 nM, >100-fold selectivity over VPAC1.

Packing Price Stock Quantity
1 mg $298 In stock
5 mg $498 In stock
10 mg $798 In stock
25 mg Get quote
100 mg Get quote

Bulk size, bulk discount!

E-mail: sales@probechem.com

Tech Support: tech@probechem.com

Purity & Documentation Purity: >98% (HPLC) Select Batch:

Biological Activity

BAY 55-9837 is a potent, highly selective peptide agonist of vasoactive intestinal peptide receptor 2 (VIPR2, VPAC2 receptor) with Kd of 0.65 nM, >100-fold selectivity over VPAC1.
BAY 55-9837 stimulated glucose-dependent insulin secretion in isolated rat and human pancreatic islets, increased insulin synthesis in purified rat islets, and caused a dose-dependent increase in plasma insulin levels in fasted rats (EC50=3 pM/kg).
Bay 55-9837 reduced the glucose area under the curve following an intraperitoneal glucose tolerance test.
Bay 55-9837 increases neuronal damage and hemorrhagic transformation after stroke in type 2 diabetic rats.

Physicochemical Properties

M.Wt 3342.20
Formula C148H239ClN44O42
Appearance Solid
CAS No.
Storage
Solide Powder
-20°C 12 Months; 4°C 6 Months
In Solvent
-80°C 6 Months; -20°C 6 Months
Shipping
Solubility

10 mM in DMSO

Chemical Name/SMILES

Peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

References

1. Tsutsumi M, et al. Diabetes. 2002 May;51(5):1453-60.

2. Hadwen J, et al. Orphanet J Rare Dis. 2014 Jan 9;9:4.

3. Darsalia V, et al. Neuropeptides. 2013 Apr;47(2):133-7.

4. Pan CQ, et al. J Pharmacol Exp Ther. 2007 Feb;320(2):900-6.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright

Contact Us sales@probechem.com

Bulk Inquiry

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • *Additional Information:

Get Quote

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • Additional Information: