Chemical Structure : BAY 55-9837
CAS No.: 463930-25-8
Catalog No.: PC-20661Not For Human Use, Lab Use Only.
BAY 55-9837 is a potent, highly selective peptide agonist of vasoactive intestinal peptide receptor 2 (VIPR2, VPAC2 receptor) with Kd of 0.65 nM, >100-fold selectivity over VPAC1.
| Packing | Price | Stock | Quantity |
|---|---|---|---|
| 1 mg | $298 | In stock | |
| 5 mg | $498 | In stock | |
| 10 mg | $798 | In stock | |
| 25 mg | Get quote | ||
| 100 mg | Get quote |
Bulk size, bulk discount!
E-mail: sales@probechem.com
Tech Support: tech@probechem.com
BAY 55-9837 is a potent, highly selective peptide agonist of vasoactive intestinal peptide receptor 2 (VIPR2, VPAC2 receptor) with Kd of 0.65 nM, >100-fold selectivity over VPAC1.
BAY 55-9837 stimulated glucose-dependent insulin secretion in isolated rat and human pancreatic islets, increased insulin synthesis in purified rat islets, and caused a dose-dependent increase in plasma insulin levels in fasted rats (EC50=3 pM/kg).
Bay 55-9837 reduced the glucose area under the curve following an intraperitoneal glucose tolerance test.
Bay 55-9837 increases neuronal damage and hemorrhagic transformation after stroke in type 2 diabetic rats.
| M.Wt | 3342.20 | |
| Formula | C148H239ClN44O42 | |
| Appearance | Solid | |
| Storage |
|
|
| Solubility |
10 mM in DMSO |
|
| Chemical Name/SMILES |
Peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY |
|
1. Tsutsumi M, et al. Diabetes. 2002 May;51(5):1453-60.
2. Hadwen J, et al. Orphanet J Rare Dis. 2014 Jan 9;9:4.
3. Darsalia V, et al. Neuropeptides. 2013 Apr;47(2):133-7.
4. Pan CQ, et al. J Pharmacol Exp Ther. 2007 Feb;320(2):900-6.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright