Welcome to ProbeChem!Global Supplier of Chemical Probes, Inhibitors & Agonists.

You are here:Home-Chemical Inhibitors & Agonists-GPCR-Vasoactive intestinal peptide receptor (VIPR)-PACAP(6-38)
PACAP(6-38)

Chemical Structure : PACAP(6-38)

CAS No.: 143748-18-9

PACAP(6-38) (PACAP 6-38)

Catalog No.: PC-23703Not For Human Use, Lab Use Only.

PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.

Packing Price Stock Quantity
2 mg $198 In stock
5 mg $358 In stock
10 mg $558 In stock
25 mg Get quote

Bulk size, bulk discount!

Welcome credit card payment!

E-mail: sales@probechem.com

Tech Support: tech@probechem.com

Purity & Documentation Purity: >98% (HPLC) Select Batch:

Biological Activity

PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.

Physicochemical Properties

M.Wt 4024.78
Formula C182H300N56O45S
Appearance Solid
CAS No.
Storage
Solide Powder
-20°C 12 Months; 4°C 6 Months
In Solvent
-80°C 6 Months; -20°C 6 Months
Shipping
Solubility

10 mM in DMSO

Chemical Name/SMILES

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
(Modifications: Lys-33 = C-terminal amide)

References

1. Gourlet P, et al. Eur J Pharmacol. 1995 Dec 4;287(1):7-11.

2. Robberecht P, et al. Eur J Biochem. 1992 Jul 1;207(1):239-46.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright

Contact Us sales@probechem.com

Bulk Inquiry

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • *Additional Information:

Get Quote

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • Additional Information: