PACAP(6-38) | PAC1R antagonist | Probechem Biochemicals

Chemical Structure : PACAP(6-38)

CAS No.: 143748-18-9

Catalog No.: PC-23703Not For Human Use, Lab Use Only.

PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.

Packing	Price	Stock
2 mg	$198	In stock
5 mg	$358	In stock
10 mg	$558	In stock
25 mg		Get quote

Get Quotation Now

or Bulk Inquiry

Bulk size, bulk discount!

Welcome credit card payment!

E-mail: sales@probechem.com

Tech Support: tech@probechem.com

Biological Activity

PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.

M.Wt	4024.78
Formula	C182H300N56O45S
Appearance	Solid
CAS No.
Storage	Solide Powder -20°C 12 Months; 4°C 6 Months	In Solvent -80°C 6 Months; -20°C 6 Months
Shipping
Solubility	10 mM in DMSO
Chemical Name/SMILES	FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-33 = C-terminal amide)

1. Gourlet P, et al. Eur J Pharmacol. 1995 Dec 4;287(1):7-11.

2. Robberecht P, et al. Eur J Biochem. 1992 Jul 1;207(1):239-46.