Chemical Structure : PACAP(6-38)
CAS No.: 143748-18-9
Catalog No.: PC-23703Not For Human Use, Lab Use Only.
PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.
Packing | Price | Stock | Quantity |
---|---|---|---|
2 mg | $198 | In stock | |
5 mg | $358 | In stock | |
10 mg | $558 | In stock | |
25 mg | Get quote |
Bulk size, bulk discount!
Welcome credit card payment!
E-mail: sales@probechem.com
Tech Support: tech@probechem.com
PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.
M.Wt | 4024.78 | |
Formula | C182H300N56O45S | |
Appearance | Solid | |
Storage |
|
|
Solubility |
10 mM in DMSO |
|
Chemical Name/SMILES |
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
1. Gourlet P, et al. Eur J Pharmacol. 1995 Dec 4;287(1):7-11.
2. Robberecht P, et al. Eur J Biochem. 1992 Jul 1;207(1):239-46.
Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright