Welcome to ProbeChem!Global Supplier of Chemical Probes, Inhibitors & Agonists.

You are here:Home-Chemical Inhibitors & Agonists-GPCR-Glucagon Receptor-Teduglutide
Teduglutide

Chemical Structure : Teduglutide

CAS No.: 197922-42-2

Teduglutide (ALX-0600, ALX0600, h[Gly(2)]GLP-2)

Catalog No.: PC-21204Not For Human Use, Lab Use Only.

Teduglutide (ALX-0600, h[Gly(2)]GLP-2) is a dipeptidyl peptidase IV resistant GLP-2 analogue, prolongs the intestinotrophic properties of GLP-2 in animal models, activates the expression of nuclear receptor subfamily 4 group a member 1 (NR4A1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis.

Packing Price Stock Quantity
5 mg $198 In stock
10 mg $328 In stock
25 mg $528 In stock
100 mg Get quote

Bulk size, bulk discount!

E-mail: sales@probechem.com

Tech Support: tech@probechem.com

Purity & Documentation Purity: >98% (HPLC) Select Batch:

Biological Activity

Teduglutide (ALX-0600, h[Gly(2)]GLP-2) is a dipeptidyl peptidase IV resistant GLP-2 analogue, prolongs the intestinotrophic properties of GLP-2 in animal models, activates the expression of nuclear receptor subfamily 4 group a member 1 (NR4A1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis.

Physicochemical Properties

M.Wt 3752.13
Formula C164H252N44O55S
Appearance Solid
CAS No.
Storage
Solide Powder
-20°C 12 Months; 4°C 6 Months
In Solvent
-80°C 6 Months; -20°C 6 Months
Shipping
Solubility

10 mM in DMSO

Chemical Name/SMILES

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

References

1. Jeppesen PB, et al. Gut. 2005 Sep;54(9):1224-31.

2. Booth C, et al. Cell Prolif. 2004 Dec;37(6):385-400.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright

Contact Us sales@probechem.com

Bulk Inquiry

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • *Additional Information:

Get Quote

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • Additional Information: