Welcome to ProbeChem!Global Supplier of Chemical Probes, Inhibitors & Agonists.

You are here:Home-Chemical Inhibitors & Agonists-GPCR-Glucagon Receptor-Teduglutide
Teduglutide

Chemical Structure : Teduglutide

CAS No.: 197922-42-2

Teduglutide (ALX-0600, ALX0600, h[Gly(2)]GLP-2)

Catalog No.: PC-21204Not For Human Use, Lab Use Only.

Teduglutide (ALX-0600, h[Gly(2)]GLP-2) is a dipeptidyl peptidase IV resistant GLP-2 analogue, prolongs the intestinotrophic properties of GLP-2 in animal models.

Packing Price Stock Quantity
5 mg $198 In stock
10 mg $328 In stock
25 mg $528 In stock
100 mg Get quote

Bulk size, bulk discount!

E-mail: sales@probechem.com

Tech Support: tech@probechem.com

Purity & Documentation Purity: >98% (HPLC) Select Batch:

Biological Activity

Teduglutide (ALX-0600, h[Gly(2)]GLP-2) is a dipeptidyl peptidase IV resistant GLP-2 analogue, prolongs the intestinotrophic properties of GLP-2 in animal models.

Physicochemical Properties

M.Wt 3752.13
Formula C164H252N44O55S
Appearance Solid
CAS No.
Storage
Solide Powder
-20°C 12 Months; 4°C 6 Months
In Solvent
-80°C 6 Months; -20°C 6 Months
Shipping
Solubility

10 mM in DMSO

Chemical Name/SMILES

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

References

1. Jeppesen PB, et al. Gut. 2005 Sep;54(9):1224-31.

2. Booth C, et al. Cell Prolif. 2004 Dec;37(6):385-400.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright

Contact Us sales@probechem.com

Bulk Inquiry

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • *Additional Information:

Get Quote

* Indicates a Required FieldYour information is safe with us.

  • *Product name:
  • *Applicant name:
  • *Email address:
  • *Organization name:
  • *Requested quantity:
  • *Country:
  • Additional Information: